General Information

  • ID:  hor001565
  • Uniprot ID:  P10552
  • Protein name:  AAMDRY-amide
  • Gene name:  FMRFa
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0002209 behavioral defense response; GO:0006942 regulation of striated muscle contraction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0008344 adult locomotory behavior; GO:0008345 larval locomotory behavior; GO:0010459 negative regulation of heart rate; GO:0045822 negative regulation of heart contraction; GO:1900075 positive regulation of neuromuscular synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AAMDRY
  • Length:  6(141-146)
  • Propeptide:  MGIALMFLLALYQMQSAIHSEIIDTPNYAGNSLQDADSEVSPSQDNDLVDALLGNDQTERAELEFRHPISVIGIDYSKNAVVLHFQKHGRKPRYKYDPELEAKRRSVQDNFMHFGKRQAEQLPPEGSYAGSDELEGMAKRAAMDRYGRDPKQDFMRFGRDPKQDFMRFGRDPKQDFMRFGRDPKQDFMRFGRDPKQDFMRFGRTPAEDFMRFGRTPAEDFMRFGRSDNFMRFGRSPHEELRSPKQDFMRFGRPDN
  • Signal peptide:  MGIALMFLLALYQMQSAIHSEI
  • Modification:  T6 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have modulatory actions at skeletal neuromuscular junctions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P13562-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P13562-F1.pdbhor001565_AF2.pdbhor001565_ESM.pdb

Physical Information

Mass: 81519 Formula: C30H47N9O10S
Absent amino acids: CEFGHIKLNPQSTVW Common amino acids: A
pI: 6.34 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -63.33 Boman Index: -1781
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 33.33
Instability Index: -1680 Extinction Coefficient cystines: 1490
Absorbance 280nm: 298

Literature

  • PubMed ID:  NA
  • Title:  NA